NCAM1 / CD56 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0393S
Article Name: NCAM1 / CD56 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0393S
Supplier Catalog Number: CNA0393S
Alternative Catalog Number: MBL-CNA0393S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 / CD56 (NP_851996.2).
Conjugation: Unconjugated
Alternative Names: CD56, NCAM, MSK39
Clonality: Polyclonal
Molecular Weight: 95kDa
NCBI: 4684
UniProt: P13591
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA
Target: NCAM1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200