Cytokeratin 13 (KRT13) Rabbit mAb, Clone: [ARC1824], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0411S
Article Name: Cytokeratin 13 (KRT13) Rabbit mAb, Clone: [ARC1824], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0411S
Supplier Catalog Number: CNA0411S
Alternative Catalog Number: MBL-CNA0411S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cytokeratin 13 (KRT13) (P13646).
Conjugation: Unconjugated
Alternative Names: K13, CK13, WSN2
Clonality: Monoclonal
Clone Designation: [ARC1824]
Molecular Weight: 50kDa
NCBI: 3860
UniProt: P13646
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LTGNEKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELAL
Target: KRT13
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200