Hsc70/HSPA8 Rabbit mAb, Clone: [ARC0258], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA0415S
| Article Name: |
Hsc70/HSPA8 Rabbit mAb, Clone: [ARC0258], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA0415S |
| Supplier Catalog Number: |
CNA0415S |
| Alternative Catalog Number: |
MBL-CNA0415S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 547-646 of human Hsc70/HSPA8 (P11142). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
LAP1, HSC54, HSC70, HSC71, HSP71, HSP73, LAP-1, NIP71, HEL-33, HSPA10, HEL-S-72p |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC0258] |
| Molecular Weight: |
71kDa |
| NCBI: |
3312 |
| UniProt: |
P11142 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
FNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD |
| Target: |
HSPA8 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
