Hsc70/HSPA8 Rabbit mAb, Clone: [ARC0258], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA0415S
Article Name: |
Hsc70/HSPA8 Rabbit mAb, Clone: [ARC0258], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA0415S |
Supplier Catalog Number: |
CNA0415S |
Alternative Catalog Number: |
MBL-CNA0415S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 547-646 of human Hsc70/HSPA8 (P11142). |
Conjugation: |
Unconjugated |
Alternative Names: |
LAP1, HSC54, HSC70, HSC71, HSP71, HSP73, LAP-1, NIP71, HEL-33, HSPA10, HEL-S-72p |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC0258] |
Molecular Weight: |
71kDa |
NCBI: |
3312 |
UniProt: |
P11142 |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
FNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD |
Target: |
HSPA8 |
Application Dilute: |
WB: WB,1:500 - 1:2000 |