IKKalpha Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0423T
Article Name: IKKalpha Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0423T
Supplier Catalog Number: CNA0423T
Alternative Catalog Number: MBL-CNA0423T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human IKKalpha (NP_001269.3).
Conjugation: Unconjugated
Alternative Names: BPS2, IKK1, IKKA, IKBKA, TCF16, NFKBIKA, IKK-alpha
Clonality: Polyclonal
Molecular Weight: 85kDa
NCBI: 1147
UniProt: O15111
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTP
Target: CHUK
Application Dilute: WB: WB,1:500 - 1:2000