N-Cadherin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0432T
Article Name: N-Cadherin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0432T
Supplier Catalog Number: CNA0432T
Alternative Catalog Number: MBL-CNA0432T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-800 of human N-Cadherin (NP_001783.2).
Conjugation: Unconjugated
Alternative Names: CDHN, NCAD, ACOGS, ADHD8, CD325, ARVD14, CDw325
Clonality: Polyclonal
Molecular Weight: 100kDa
NCBI: 1000
UniProt: P19022
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: NPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKER
Target: CDH2
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200