N-Cadherin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0433P
Article Name: N-Cadherin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0433P
Supplier Catalog Number: CNA0433P
Alternative Catalog Number: MBL-CNA0433P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human N-Cadherin (NP_001783.2).
Conjugation: Unconjugated
Alternative Names: CDHN, NCAD, ACOGS, ADHD8, CD325, ARVD14, CDw325
Clonality: Polyclonal
Molecular Weight: 100kDa
NCBI: 1000
UniProt: P19022
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: IDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVN
Target: CDH2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200