CARS Rabbit mAb, Clone: [ARC2504], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0438S
Article Name: CARS Rabbit mAb, Clone: [ARC2504], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0438S
Supplier Catalog Number: CNA0438S
Alternative Catalog Number: MBL-CNA0438S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 650-748 of human CARS (P49589).
Conjugation: Unconjugated
Alternative Names: CARS, MDBH, CYSRS, MCDDBH, MGC:11246
Clonality: Monoclonal
Clone Designation: [ARC2504]
Molecular Weight: 85kDa
NCBI: 833
UniProt: P49589
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ
Target: CARS1
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200