HLA-DRB4 Rabbit mAb, Clone: [ARC2505], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0439S
Article Name: HLA-DRB4 Rabbit mAb, Clone: [ARC2505], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0439S
Supplier Catalog Number: CNA0439S
Alternative Catalog Number: MBL-CNA0439S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HLA-DRB4 (P13762).
Conjugation: Unconjugated
Alternative Names: DR4, DRB4, HLA-DRB, HLA-DR4B, HLA-DRB4
Clonality: Monoclonal
Clone Designation: [ARC2505]
Molecular Weight: 30kDa
NCBI: 3126
UniProt: P13762
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: TERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
Target: HLA-DRB4
Application Dilute: WB: WB,1:500 - 1:1000