Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0461T
Article Name: Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0461T
Supplier Catalog Number: CNA0461T
Alternative Catalog Number: MBL-CNA0461T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2221-2511 of human Fatty Acid Synthase (FASN) (NP_004095.4).
Conjugation: Unconjugated
Alternative Names: FAS, OA-519, SDR27X1
Clonality: Polyclonal
Molecular Weight: 273kDa
NCBI: 2194
UniProt: P49327
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSV
Target: FASN
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100