Chk2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0466S
Article Name: Chk2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0466S
Supplier Catalog Number: CNA0466S
Alternative Catalog Number: MBL-CNA0466S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human Chk2 (NP_009125.1).
Conjugation: Unconjugated
Alternative Names: CDS1, CHK2, LFS2, RAD53, hCds1, HuCds1, PP1425
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 11200
UniProt: O96017
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEY
Target: CHEK2
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50