TSC2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0492P
Article Name: TSC2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0492P
Supplier Catalog Number: CNA0492P
Alternative Catalog Number: MBL-CNA0492P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1255 of human TSC2 (NP_000539.2).
Conjugation: Unconjugated
Alternative Names: LAM, TSC4, PPP1R160
Clonality: Polyclonal
Molecular Weight: 201kDa
NCBI: 7249
UniProt: P49815
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: TAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSV
Target: TSC2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200