N-Myc/MYCN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0499S
Article Name: N-Myc/MYCN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0499S
Supplier Catalog Number: CNA0499S
Alternative Catalog Number: MBL-CNA0499S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 168-267 of human N-Myc/MYCN (NP_005369.2).
Conjugation: Unconjugated
Alternative Names: NMYC, ODED, MODED, N-myc, bHLHe37, MYCNsORF, MYCNsPEP
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 4613
UniProt: P04198
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: AGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDED
Target: MYCN
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200