UBE2B Rabbit mAb, Clone: [ARC2512], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0503S
Article Name: UBE2B Rabbit mAb, Clone: [ARC2512], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0503S
Supplier Catalog Number: CNA0503S
Alternative Catalog Number: MBL-CNA0503S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 53-152 of human UBE2B (P63146).
Conjugation: Unconjugated
Alternative Names: HR6B, UBC2, HHR6B, RAD6B, E2-17kDa
Clonality: Monoclonal
Clone Designation: [ARC2512]
Molecular Weight: 17kDa
NCBI: 7320
UniProt: P63146
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: FKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS
Target: UBE2B
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200