CRKL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0511S
Article Name: CRKL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0511S
Supplier Catalog Number: CNA0511S
Alternative Catalog Number: MBL-CNA0511S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CRKL (P46109).
Conjugation: Unconjugated
Alternative Names: CRKL
Clonality: Polyclonal
Molecular Weight: 34kDa
Sensitivity: 1 mg/mL
NCBI: 1399
UniProt: P46109
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: AYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Target: CRKL
Application Dilute: WB: WB,1:500 - 1:2000