Timeless Rabbit mAb, Clone: [ARC1827], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0512S
Article Name: Timeless Rabbit mAb, Clone: [ARC1827], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0512S
Supplier Catalog Number: CNA0512S
Alternative Catalog Number: MBL-CNA0512S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1058-1208 of human Timeless (Q9UNS1).
Conjugation: Unconjugated
Alternative Names: TIM, TIM1, hTIM, FASPS4
Clonality: Monoclonal
Clone Designation: [ARC1827]
Molecular Weight: 139kDa
NCBI: 8914
UniProt: Q9UNS1
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EQFQQLLRKLGVRPPASGQETFWRIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDEDD
Target: TIMELESS
Application Dilute: WB: WB,1:500 - 1:1000