IRF4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0524T
Article Name: IRF4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0524T
Supplier Catalog Number: CNA0524T
Alternative Catalog Number: MBL-CNA0524T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 150-350 of human IRF4 (NP_002451.2).
Conjugation: Unconjugated
Alternative Names: MUM1, LSIRF, SHEP8, NF-EM5
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 3662
UniProt: Q15306
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKL
Target: IRF4
Application Dilute: WB: WB,1:500 - 1:1000