NUP98 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0530S
Article Name: NUP98 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0530S
Supplier Catalog Number: CNA0530S
Alternative Catalog Number: MBL-CNA0530S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 621-920 of human NUP98 (NP_624357.1).
Conjugation: Unconjugated
Alternative Names: ADIR2, NUP96, NUP196, Nup98-96
Clonality: Polyclonal
Molecular Weight: 198kDa
NCBI: 4928
UniProt: P52948
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEE
Target: NUP98
Application Dilute: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200