[KO Validated] HK1 Rabbit mAb, Clone: [ARC0256], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0533S
Article Name: [KO Validated] HK1 Rabbit mAb, Clone: [ARC0256], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0533S
Supplier Catalog Number: CNA0533S
Alternative Catalog Number: MBL-CNA0533S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Hexokinase 1 (P19367).
Conjugation: Unconjugated
Alternative Names: HK, HKD, HKI, HXK1, NMSR, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase
Clonality: Monoclonal
Clone Designation: [ARC0256]
Molecular Weight: 102kDa
Sensitivity: 0.647 mg/mL
NCBI: 3098
UniProt: P19367
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPV
Target: HK1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000