GTF2F2 Rabbit mAb, Clone: [ARC2513], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0536S
Article Name: GTF2F2 Rabbit mAb, Clone: [ARC2513], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0536S
Supplier Catalog Number: CNA0536S
Alternative Catalog Number: MBL-CNA0536S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GTF2F2 (P13984).
Conjugation: Unconjugated
Alternative Names: BTF4, RAP30, TF2F2, TFIIF
Clonality: Monoclonal
Clone Designation: [ARC2513]
Molecular Weight: 28kDa
NCBI: 2963
UniProt: P13984
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS
Target: GTF2F2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200