NEDD4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0552S
Article Name: NEDD4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0552S
Supplier Catalog Number: CNA0552S
Alternative Catalog Number: MBL-CNA0552S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-460 of human NEDD4 (NP_940682.2).
Conjugation: Unconjugated
Alternative Names: RPF1, NEDD4-1
Clonality: Polyclonal
Molecular Weight: 149kDa
NCBI: 4734
UniProt: P46934
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GSYSSNGSDFGSCASITSGGSYTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDDLEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFIISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNTPRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYI
Target: NEDD4
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200