SOX2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0561P
Article Name: SOX2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0561P
Supplier Catalog Number: CNA0561P
Alternative Catalog Number: MBL-CNA0561P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SOX2 (NP_003097.1).
Conjugation: Unconjugated
Alternative Names: ANOP3, MCOPS3
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 6657
UniProt: P48431
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA
Target: SOX2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200