PGD Rabbit mAb, Clone: [ARC2516], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0563S
Article Name: PGD Rabbit mAb, Clone: [ARC2516], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0563S
Supplier Catalog Number: CNA0563S
Alternative Catalog Number: MBL-CNA0563S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 384-483 of human PGD (P52209).
Conjugation: Unconjugated
Alternative Names: 6PGD
Clonality: Monoclonal
Clone Designation: [ARC2516]
Molecular Weight: 53kDa
NCBI: 5226
UniProt: P52209
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
Target: PGD
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000