Pumilio 1 Rabbit mAb, Clone: [ARC1830], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0571S
Article Name: Pumilio 1 Rabbit mAb, Clone: [ARC1830], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0571S
Supplier Catalog Number: CNA0571S
Alternative Catalog Number: MBL-CNA0571S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 104-203 of human Pumilio 1 (Q14671).
Conjugation: Unconjugated
Alternative Names: PUMH, HSPUM, PUMH1, PUML1, SCA47
Clonality: Monoclonal
Clone Designation: [ARC1830]
Molecular Weight: 126kDa
NCBI: 9698
UniProt: Q14671
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: NNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSE
Target: PUM1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200