PEBP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0578S
Article Name: PEBP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0578S
Supplier Catalog Number: CNA0578S
Alternative Catalog Number: MBL-CNA0578S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human PEBP1 (NP_002558.1).
Conjugation: Unconjugated
Alternative Names: PBP, HCNP, PEBP, RKIP, HCNPpp, PEBP-1, HEL-210, HEL-S-34, HEL-S-96
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 5037
UniProt: P30086
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Target: PEBP1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50