Smad6 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0579S
Article Name: |
Smad6 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA0579S |
Supplier Catalog Number: |
CNA0579S |
Alternative Catalog Number: |
MBL-CNA0579S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 257-496 of human Smad6 (NP_005576.3). |
Conjugation: |
Unconjugated |
Alternative Names: |
AOVD2, MADH6, MADH7, HsT17432 |
Clonality: |
Polyclonal |
Molecular Weight: |
53kDa |
NCBI: |
4091 |
UniProt: |
O43541 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
PTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNPR |
Target: |
SMAD6 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |