Smad6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0579S
Article Name: Smad6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0579S
Supplier Catalog Number: CNA0579S
Alternative Catalog Number: MBL-CNA0579S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 257-496 of human Smad6 (NP_005576.3).
Conjugation: Unconjugated
Alternative Names: AOVD2, MADH6, MADH7, HsT17432
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 4091
UniProt: O43541
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNPR
Target: SMAD6
Application Dilute: WB: WB,1:500 - 1:1000