PIST/GOPC Rabbit mAb, Clone: [ARC1831], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0582S
Article Name: PIST/GOPC Rabbit mAb, Clone: [ARC1831], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0582S
Supplier Catalog Number: CNA0582S
Alternative Catalog Number: MBL-CNA0582S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIST/GOPC (Q9HD26).
Conjugation: Unconjugated
Alternative Names: CAL, FIG, PIST, GOPC1, dJ94G16.2
Clonality: Monoclonal
Clone Designation: [ARC1831]
Molecular Weight: 51kDa
NCBI: 57120
UniProt: Q9HD26
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVD
Target: GOPC
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200