PPP1R12A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0587T
Article Name: PPP1R12A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0587T
Supplier Catalog Number: CNA0587T
Alternative Catalog Number: MBL-CNA0587T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PPP1R12A (NP_002471.1).
Conjugation: Unconjugated
Alternative Names: MBS, GUBS, M130, MYPT1
Clonality: Polyclonal
Molecular Weight: 115kDa
NCBI: 4659
UniProt: O14974
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGG
Target: PPP1R12A
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100