LAMP2 Rabbit mAb, Clone: [ARC0274], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0593S
Article Name: LAMP2 Rabbit mAb, Clone: [ARC0274], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0593S
Supplier Catalog Number: CNA0593S
Alternative Catalog Number: MBL-CNA0593S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 311-410 of human LAMP2 (P13473).
Conjugation: Unconjugated
Alternative Names: DND, LAMPB, CD107b, LAMP-2, LGP-96, LGP110
Clonality: Monoclonal
Clone Designation: [ARC0274]
Molecular Weight: 45kDa
NCBI: 3920
UniProt: P13473
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: FSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF
Target: LAMP2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000