TJP2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0594S
Article Name: |
TJP2 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA0594S |
Supplier Catalog Number: |
CNA0594S |
Alternative Catalog Number: |
MBL-CNA0594S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IP, WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 951-1190 of human TJP2 (NP_004808.2). |
Conjugation: |
Unconjugated |
Alternative Names: |
ZO2, X104, FHCA1, PFIC4, DFNA51, DUP9q21.11, C9DUPq21.11 |
Clonality: |
Polyclonal |
Molecular Weight: |
134kDa |
NCBI: |
9414 |
UniProt: |
Q9UDY2 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
RSSEPVQHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL |
Target: |
TJP2 |
Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000 |