DYRK1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0595S
Article Name: DYRK1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0595S
Supplier Catalog Number: CNA0595S
Alternative Catalog Number: MBL-CNA0595S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 624-763 of human DYRK1A (NP_001387.2).
Conjugation: Unconjugated
Alternative Names: MNB, DYRK, HP86, MNBH, MRD7, DYRK1
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 1859
UniProt: Q13627
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Target: DYRK1A
Application Dilute: WB: WB,1:500 - 1:1000