NCS1 Rabbit mAb, Clone: [ARC2523], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA0598S
| Article Name: |
NCS1 Rabbit mAb, Clone: [ARC2523], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA0598S |
| Supplier Catalog Number: |
CNA0598S |
| Alternative Catalog Number: |
MBL-CNA0598S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 91-190 of human NCS1 (P62166). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
FLUP, FREQ |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC2523] |
| Molecular Weight: |
22kDa |
| NCBI: |
23413 |
| UniProt: |
P62166 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
VTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV |
| Target: |
NCS1 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
