Olig3 Rabbit mAb, Clone: [ARC2524], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA0600S
Article Name: |
Olig3 Rabbit mAb, Clone: [ARC2524], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA0600S |
Supplier Catalog Number: |
CNA0600S |
Alternative Catalog Number: |
MBL-CNA0600S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 173-272 of human Olig3 (Q7RTU3). |
Conjugation: |
Unconjugated |
Alternative Names: |
Bhlhb7, bHLHe20 |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC2524] |
Molecular Weight: |
29kDa |
NCBI: |
167826 |
UniProt: |
Q7RTU3 |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
HAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK |
Target: |
OLIG3 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |