NUDT5 Rabbit mAb, Clone: [ARC2525], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0609S
Article Name: NUDT5 Rabbit mAb, Clone: [ARC2525], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0609S
Supplier Catalog Number: CNA0609S
Alternative Catalog Number: MBL-CNA0609S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDT5 (Q9UKK9).
Conjugation: Unconjugated
Alternative Names: YSA1, YSA1H, YSAH1, hNUDT5
Clonality: Monoclonal
Clone Designation: [ARC2525]
Molecular Weight: 24kDa
NCBI: 11164
UniProt: Q9UKK9
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLID
Target: NUDT5
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200