UPP1 Rabbit mAb, Clone: [ARC2531], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0613S
Article Name: UPP1 Rabbit mAb, Clone: [ARC2531], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0613S
Supplier Catalog Number: CNA0613S
Alternative Catalog Number: MBL-CNA0613S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UPP1 (Q16831).
Conjugation: Unconjugated
Alternative Names: UP, UPP, UPASE, UDRPASE
Clonality: Monoclonal
Clone Designation: [ARC2531]
Molecular Weight: 34kDa
NCBI: 7378
UniProt: Q16831
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKV
Target: UPP1
Application Dilute: WB: WB,1:500 - 1:1000