INCENP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0622S
Article Name: INCENP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0622S
Supplier Catalog Number: CNA0622S
Alternative Catalog Number: MBL-CNA0622S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 785-914 of human INCENP (NP_064623.2).
Conjugation: Unconjugated
Alternative Names: INCENP
Clonality: Polyclonal
Molecular Weight: 105kDa
NCBI: 3619
UniProt: Q9NQS7
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: ALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSSLAYSLKKH
Target: INCENP
Application Dilute: WB: WB,1:500 - 1:2000