Lysozyme (LYZ) Rabbit mAb, Clone: [ARC0276], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0641S
Article Name: Lysozyme (LYZ) Rabbit mAb, Clone: [ARC0276], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0641S
Supplier Catalog Number: CNA0641S
Alternative Catalog Number: MBL-CNA0641S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (P61626).
Conjugation: Unconjugated
Alternative Names: LZM, LYZF1
Clonality: Monoclonal
Clone Designation: [ARC0276]
Molecular Weight: 17kDa
NCBI: 4069
UniProt: P61626
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
Target: LYZ
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200