WNT3A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0642P
Article Name: WNT3A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0642P
Supplier Catalog Number: CNA0642P
Alternative Catalog Number: MBL-CNA0642P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human WNT3A (NP_149122.1).
Conjugation: Unconjugated
Alternative Names: WNT3A
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 89780
UniProt: P56704
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: PVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMH
Target: WNT3A
Application Dilute: WB: WB,1:500 - 1:1000