Histone H1.2 Rabbit mAb, Clone: [ARC1836], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0646S
Article Name: Histone H1.2 Rabbit mAb, Clone: [ARC1836], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0646S
Supplier Catalog Number: CNA0646S
Alternative Catalog Number: MBL-CNA0646S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H1.2 (P16403).
Conjugation: Unconjugated
Alternative Names: H1C,H1.2,H1F2,H1s-1,HIST1H1C
Clonality: Monoclonal
Clone Designation: [ARC1836]
Molecular Weight: 21kDa
NCBI: 3006
UniProt: P16403
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG
Target: H1-2
Application Dilute: WB: WB,1:1000 -1:5000|IF/ICC,1:50 - 1:500