SNRPA1 Rabbit mAb, Clone: [ARC2532], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0647S
Article Name: SNRPA1 Rabbit mAb, Clone: [ARC2532], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0647S
Supplier Catalog Number: CNA0647S
Alternative Catalog Number: MBL-CNA0647S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 156-255 of human SNRPA1 (P09661).
Conjugation: Unconjugated
Alternative Names: Lea1, U2A
Clonality: Monoclonal
Clone Designation: [ARC2532]
Molecular Weight: 28kDa
NCBI: 6627
UniProt: P09661
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: QEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS
Target: SNRPA1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200