CPT2 Rabbit mAb, Clone: [ARC0516], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0653S
Article Name: CPT2 Rabbit mAb, Clone: [ARC0516], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0653S
Supplier Catalog Number: CNA0653S
Alternative Catalog Number: MBL-CNA0653S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 559-658 of human CPT2 (P23786).
Conjugation: Unconjugated
Alternative Names: CPT1, IIAE4, CPTASE
Clonality: Monoclonal
Clone Designation: [ARC0516]
Molecular Weight: 74kDa
Sensitivity: 0.5 mg/mL
NCBI: 1376
UniProt: P23786
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLGGFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS
Target: CPT2
Application Dilute: WB: WB,1:500 - 1:1000