RCC1 Rabbit mAb, Clone: [ARC1834], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA0662S
| Article Name: |
RCC1 Rabbit mAb, Clone: [ARC1834], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA0662S |
| Supplier Catalog Number: |
CNA0662S |
| Alternative Catalog Number: |
MBL-CNA0662S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RCC1 (P18754). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CHC1, RCC1-I |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC1834] |
| Molecular Weight: |
45kDa |
| NCBI: |
1104 |
| UniProt: |
P18754 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALG |
| Target: |
RCC1 |
| Application Dilute: |
WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200 |
