CD8A Rabbit mAb, Clone: [ARC0329], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0663S
Article Name: CD8A Rabbit mAb, Clone: [ARC0329], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0663S
Supplier Catalog Number: CNA0663S
Alternative Catalog Number: MBL-CNA0663S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: FC, IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 136-235 of human CD8A (P01732).
Conjugation: Unconjugated
Alternative Names: CD8, p32, Leu2, CD8alpha
Clonality: Monoclonal
Clone Designation: [ARC0329]
Molecular Weight: 26kDa
NCBI: 925
UniProt: P01732
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Target: CD8A
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|FC,1:50 - 1:200