CSK Rabbit mAb, Clone: [ARC1835], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0666S
Article Name: CSK Rabbit mAb, Clone: [ARC1835], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0666S
Supplier Catalog Number: CNA0666S
Alternative Catalog Number: MBL-CNA0666S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CSK (P41240).
Conjugation: Unconjugated
Alternative Names: CSK, tyrosine-protein kinase CSK
Clonality: Monoclonal
Clone Designation: [ARC1835]
Molecular Weight: 51kDa
NCBI: 1445
UniProt: P41240
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE
Target: CSK
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200