GATA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0677S
Article Name: GATA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0677S
Supplier Catalog Number: CNA0677S
Alternative Catalog Number: MBL-CNA0677S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GATA2 (NP_116027.2).
Conjugation: Unconjugated
Alternative Names: DCML, IMD21, NFE1B, MONOMAC
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 2624
UniProt: P23769
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVP
Target: GATA2
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200