ACVR1C Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0678P
Article Name: ACVR1C Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0678P
Supplier Catalog Number: CNA0678P
Alternative Catalog Number: MBL-CNA0678P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2).
Conjugation: Unconjugated
Alternative Names: ALK7, ACVRLK7
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 130399
UniProt: Q8NER5
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
Target: ACVR1C
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200