STEAP3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0683S
| Article Name: |
STEAP3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0683S |
| Supplier Catalog Number: |
CNA0683S |
| Alternative Catalog Number: |
MBL-CNA0683S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human STEAP3 (NP_060704.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
STMP3, TSAP6, pHyde, AHMIO2, dudlin-2, dudulin-2 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
55kDa |
| NCBI: |
55240 |
| UniProt: |
Q658P3 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE |
| Target: |
STEAP3 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
