Endothelin 1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0686P
Article Name: Endothelin 1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0686P
Supplier Catalog Number: CNA0686P
Alternative Catalog Number: MBL-CNA0686P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-212 of human Endothelin 1 (NP_001946.3).
Conjugation: Unconjugated
Alternative Names: ET1, QME, PPET1, ARCND3, HDLCQ7
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 1906
UniProt: P05305
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: APETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW
Target: EDN1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200