IL17A Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0688P
| Article Name: |
IL17A Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0688P |
| Supplier Catalog Number: |
CNA0688P |
| Alternative Catalog Number: |
MBL-CNA0688P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 24-155 of human IL17A (NP_002181.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
IL17, CTLA8, IL-17, ILA17, CTLA-8, IL-17A |
| Clonality: |
Polyclonal |
| Molecular Weight: |
18kDa |
| NCBI: |
3605 |
| UniProt: |
Q16552 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Target: |
IL17A |
| Application Dilute: |
WB: WB,1:100 - 1:500|IF,1:50 - 1:200 |
