IL17A Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0688P
Article Name: |
IL17A Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA0688P |
Supplier Catalog Number: |
CNA0688P |
Alternative Catalog Number: |
MBL-CNA0688P |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 24-155 of human IL17A (NP_002181.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
IL17, CTLA8, IL-17, ILA17, CTLA-8, IL-17A |
Clonality: |
Polyclonal |
Molecular Weight: |
18kDa |
NCBI: |
3605 |
UniProt: |
Q16552 |
Buffer: |
PBS with 0.05% proclin300,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.05% proclin300,50% glycerol |
Sequence: |
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Target: |
IL17A |
Application Dilute: |
WB: WB,1:100 - 1:500|IF,1:50 - 1:200 |