ANGPTL3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0689S
Article Name: ANGPTL3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0689S
Supplier Catalog Number: CNA0689S
Alternative Catalog Number: MBL-CNA0689S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 231-460 of human ANGPTL3 (NP_055310.1).
Conjugation: Unconjugated
Alternative Names: ANL3, ANG-5, FHBL2, ANGPT5
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 27329
UniProt: Q9Y5C1
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Target: ANGPTL3
Application Dilute: WB: WB,1:500 - 1:2000