ATG13 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0690S
Article Name: ATG13 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0690S
Supplier Catalog Number: CNA0690S
Alternative Catalog Number: MBL-CNA0690S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 281-480 of human ATG13 (NP_055556.2).
Conjugation: Unconjugated
Alternative Names: KIAA0652, PARATARG8
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 9776
UniProt: O75143
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: VHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
Target: ATG13
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200